Metadata-Version: 2.2
Name: pyfamsa
Version: 0.6.1
Summary: Cython bindings and Python interface to FAMSA, an algorithm for ultra-scale multiple sequence alignments.
Keywords: bioinformatics,sequence,alignment,protein,MSA
Author-Email: Martin Larralde <martin.larralde@embl.de>
License:                     GNU GENERAL PUBLIC LICENSE
                                Version 3, 29 June 2007
         
          Copyright (C) 2007 Free Software Foundation, Inc. <http://fsf.org/>
          Everyone is permitted to copy and distribute verbatim copies
          of this license document, but changing it is not allowed.
         
                                     Preamble
         
           The GNU General Public License is a free, copyleft license for
         software and other kinds of works.
         
           The licenses for most software and other practical works are designed
         to take away your freedom to share and change the works.  By contrast,
         the GNU General Public License is intended to guarantee your freedom to
         share and change all versions of a program--to make sure it remains free
         software for all its users.  We, the Free Software Foundation, use the
         GNU General Public License for most of our software; it applies also to
         any other work released this way by its authors.  You can apply it to
         your programs, too.
         
           When we speak of free software, we are referring to freedom, not
         price.  Our General Public Licenses are designed to make sure that you
         have the freedom to distribute copies of free software (and charge for
         them if you wish), that you receive source code or can get it if you
         want it, that you can change the software or use pieces of it in new
         free programs, and that you know you can do these things.
         
           To protect your rights, we need to prevent others from denying you
         these rights or asking you to surrender the rights.  Therefore, you have
         certain responsibilities if you distribute copies of the software, or if
         you modify it: responsibilities to respect the freedom of others.
         
           For example, if you distribute copies of such a program, whether
         gratis or for a fee, you must pass on to the recipients the same
         freedoms that you received.  You must make sure that they, too, receive
         or can get the source code.  And you must show them these terms so they
         know their rights.
         
           Developers that use the GNU GPL protect your rights with two steps:
         (1) assert copyright on the software, and (2) offer you this License
         giving you legal permission to copy, distribute and/or modify it.
         
           For the developers' and authors' protection, the GPL clearly explains
         that there is no warranty for this free software.  For both users' and
         authors' sake, the GPL requires that modified versions be marked as
         changed, so that their problems will not be attributed erroneously to
         authors of previous versions.
         
           Some devices are designed to deny users access to install or run
         modified versions of the software inside them, although the manufacturer
         can do so.  This is fundamentally incompatible with the aim of
         protecting users' freedom to change the software.  The systematic
         pattern of such abuse occurs in the area of products for individuals to
         use, which is precisely where it is most unacceptable.  Therefore, we
         have designed this version of the GPL to prohibit the practice for those
         products.  If such problems arise substantially in other domains, we
         stand ready to extend this provision to those domains in future versions
         of the GPL, as needed to protect the freedom of users.
         
           Finally, every program is threatened constantly by software patents.
         States should not allow patents to restrict development and use of
         software on general-purpose computers, but in those that do, we wish to
         avoid the special danger that patents applied to a free program could
         make it effectively proprietary.  To prevent this, the GPL assures that
         patents cannot be used to render the program non-free.
         
           The precise terms and conditions for copying, distribution and
         modification follow.
         
                                TERMS AND CONDITIONS
         
           0. Definitions.
         
           "This License" refers to version 3 of the GNU General Public License.
         
           "Copyright" also means copyright-like laws that apply to other kinds of
         works, such as semiconductor masks.
         
           "The Program" refers to any copyrightable work licensed under this
         License.  Each licensee is addressed as "you".  "Licensees" and
         "recipients" may be individuals or organizations.
         
           To "modify" a work means to copy from or adapt all or part of the work
         in a fashion requiring copyright permission, other than the making of an
         exact copy.  The resulting work is called a "modified version" of the
         earlier work or a work "based on" the earlier work.
         
           A "covered work" means either the unmodified Program or a work based
         on the Program.
         
           To "propagate" a work means to do anything with it that, without
         permission, would make you directly or secondarily liable for
         infringement under applicable copyright law, except executing it on a
         computer or modifying a private copy.  Propagation includes copying,
         distribution (with or without modification), making available to the
         public, and in some countries other activities as well.
         
           To "convey" a work means any kind of propagation that enables other
         parties to make or receive copies.  Mere interaction with a user through
         a computer network, with no transfer of a copy, is not conveying.
         
           An interactive user interface displays "Appropriate Legal Notices"
         to the extent that it includes a convenient and prominently visible
         feature that (1) displays an appropriate copyright notice, and (2)
         tells the user that there is no warranty for the work (except to the
         extent that warranties are provided), that licensees may convey the
         work under this License, and how to view a copy of this License.  If
         the interface presents a list of user commands or options, such as a
         menu, a prominent item in the list meets this criterion.
         
           1. Source Code.
         
           The "source code" for a work means the preferred form of the work
         for making modifications to it.  "Object code" means any non-source
         form of a work.
         
           A "Standard Interface" means an interface that either is an official
         standard defined by a recognized standards body, or, in the case of
         interfaces specified for a particular programming language, one that
         is widely used among developers working in that language.
         
           The "System Libraries" of an executable work include anything, other
         than the work as a whole, that (a) is included in the normal form of
         packaging a Major Component, but which is not part of that Major
         Component, and (b) serves only to enable use of the work with that
         Major Component, or to implement a Standard Interface for which an
         implementation is available to the public in source code form.  A
         "Major Component", in this context, means a major essential component
         (kernel, window system, and so on) of the specific operating system
         (if any) on which the executable work runs, or a compiler used to
         produce the work, or an object code interpreter used to run it.
         
           The "Corresponding Source" for a work in object code form means all
         the source code needed to generate, install, and (for an executable
         work) run the object code and to modify the work, including scripts to
         control those activities.  However, it does not include the work's
         System Libraries, or general-purpose tools or generally available free
         programs which are used unmodified in performing those activities but
         which are not part of the work.  For example, Corresponding Source
         includes interface definition files associated with source files for
         the work, and the source code for shared libraries and dynamically
         linked subprograms that the work is specifically designed to require,
         such as by intimate data communication or control flow between those
         subprograms and other parts of the work.
         
           The Corresponding Source need not include anything that users
         can regenerate automatically from other parts of the Corresponding
         Source.
         
           The Corresponding Source for a work in source code form is that
         same work.
         
           2. Basic Permissions.
         
           All rights granted under this License are granted for the term of
         copyright on the Program, and are irrevocable provided the stated
         conditions are met.  This License explicitly affirms your unlimited
         permission to run the unmodified Program.  The output from running a
         covered work is covered by this License only if the output, given its
         content, constitutes a covered work.  This License acknowledges your
         rights of fair use or other equivalent, as provided by copyright law.
         
           You may make, run and propagate covered works that you do not
         convey, without conditions so long as your license otherwise remains
         in force.  You may convey covered works to others for the sole purpose
         of having them make modifications exclusively for you, or provide you
         with facilities for running those works, provided that you comply with
         the terms of this License in conveying all material for which you do
         not control copyright.  Those thus making or running the covered works
         for you must do so exclusively on your behalf, under your direction
         and control, on terms that prohibit them from making any copies of
         your copyrighted material outside their relationship with you.
         
           Conveying under any other circumstances is permitted solely under
         the conditions stated below.  Sublicensing is not allowed; section 10
         makes it unnecessary.
         
           3. Protecting Users' Legal Rights From Anti-Circumvention Law.
         
           No covered work shall be deemed part of an effective technological
         measure under any applicable law fulfilling obligations under article
         11 of the WIPO copyright treaty adopted on 20 December 1996, or
         similar laws prohibiting or restricting circumvention of such
         measures.
         
           When you convey a covered work, you waive any legal power to forbid
         circumvention of technological measures to the extent such circumvention
         is effected by exercising rights under this License with respect to
         the covered work, and you disclaim any intention to limit operation or
         modification of the work as a means of enforcing, against the work's
         users, your or third parties' legal rights to forbid circumvention of
         technological measures.
         
           4. Conveying Verbatim Copies.
         
           You may convey verbatim copies of the Program's source code as you
         receive it, in any medium, provided that you conspicuously and
         appropriately publish on each copy an appropriate copyright notice;
         keep intact all notices stating that this License and any
         non-permissive terms added in accord with section 7 apply to the code;
         keep intact all notices of the absence of any warranty; and give all
         recipients a copy of this License along with the Program.
         
           You may charge any price or no price for each copy that you convey,
         and you may offer support or warranty protection for a fee.
         
           5. Conveying Modified Source Versions.
         
           You may convey a work based on the Program, or the modifications to
         produce it from the Program, in the form of source code under the
         terms of section 4, provided that you also meet all of these conditions:
         
             a) The work must carry prominent notices stating that you modified
             it, and giving a relevant date.
         
             b) The work must carry prominent notices stating that it is
             released under this License and any conditions added under section
             7.  This requirement modifies the requirement in section 4 to
             "keep intact all notices".
         
             c) You must license the entire work, as a whole, under this
             License to anyone who comes into possession of a copy.  This
             License will therefore apply, along with any applicable section 7
             additional terms, to the whole of the work, and all its parts,
             regardless of how they are packaged.  This License gives no
             permission to license the work in any other way, but it does not
             invalidate such permission if you have separately received it.
         
             d) If the work has interactive user interfaces, each must display
             Appropriate Legal Notices; however, if the Program has interactive
             interfaces that do not display Appropriate Legal Notices, your
             work need not make them do so.
         
           A compilation of a covered work with other separate and independent
         works, which are not by their nature extensions of the covered work,
         and which are not combined with it such as to form a larger program,
         in or on a volume of a storage or distribution medium, is called an
         "aggregate" if the compilation and its resulting copyright are not
         used to limit the access or legal rights of the compilation's users
         beyond what the individual works permit.  Inclusion of a covered work
         in an aggregate does not cause this License to apply to the other
         parts of the aggregate.
         
           6. Conveying Non-Source Forms.
         
           You may convey a covered work in object code form under the terms
         of sections 4 and 5, provided that you also convey the
         machine-readable Corresponding Source under the terms of this License,
         in one of these ways:
         
             a) Convey the object code in, or embodied in, a physical product
             (including a physical distribution medium), accompanied by the
             Corresponding Source fixed on a durable physical medium
             customarily used for software interchange.
         
             b) Convey the object code in, or embodied in, a physical product
             (including a physical distribution medium), accompanied by a
             written offer, valid for at least three years and valid for as
             long as you offer spare parts or customer support for that product
             model, to give anyone who possesses the object code either (1) a
             copy of the Corresponding Source for all the software in the
             product that is covered by this License, on a durable physical
             medium customarily used for software interchange, for a price no
             more than your reasonable cost of physically performing this
             conveying of source, or (2) access to copy the
             Corresponding Source from a network server at no charge.
         
             c) Convey individual copies of the object code with a copy of the
             written offer to provide the Corresponding Source.  This
             alternative is allowed only occasionally and noncommercially, and
             only if you received the object code with such an offer, in accord
             with subsection 6b.
         
             d) Convey the object code by offering access from a designated
             place (gratis or for a charge), and offer equivalent access to the
             Corresponding Source in the same way through the same place at no
             further charge.  You need not require recipients to copy the
             Corresponding Source along with the object code.  If the place to
             copy the object code is a network server, the Corresponding Source
             may be on a different server (operated by you or a third party)
             that supports equivalent copying facilities, provided you maintain
             clear directions next to the object code saying where to find the
             Corresponding Source.  Regardless of what server hosts the
             Corresponding Source, you remain obligated to ensure that it is
             available for as long as needed to satisfy these requirements.
         
             e) Convey the object code using peer-to-peer transmission, provided
             you inform other peers where the object code and Corresponding
             Source of the work are being offered to the general public at no
             charge under subsection 6d.
         
           A separable portion of the object code, whose source code is excluded
         from the Corresponding Source as a System Library, need not be
         included in conveying the object code work.
         
           A "User Product" is either (1) a "consumer product", which means any
         tangible personal property which is normally used for personal, family,
         or household purposes, or (2) anything designed or sold for incorporation
         into a dwelling.  In determining whether a product is a consumer product,
         doubtful cases shall be resolved in favor of coverage.  For a particular
         product received by a particular user, "normally used" refers to a
         typical or common use of that class of product, regardless of the status
         of the particular user or of the way in which the particular user
         actually uses, or expects or is expected to use, the product.  A product
         is a consumer product regardless of whether the product has substantial
         commercial, industrial or non-consumer uses, unless such uses represent
         the only significant mode of use of the product.
         
           "Installation Information" for a User Product means any methods,
         procedures, authorization keys, or other information required to install
         and execute modified versions of a covered work in that User Product from
         a modified version of its Corresponding Source.  The information must
         suffice to ensure that the continued functioning of the modified object
         code is in no case prevented or interfered with solely because
         modification has been made.
         
           If you convey an object code work under this section in, or with, or
         specifically for use in, a User Product, and the conveying occurs as
         part of a transaction in which the right of possession and use of the
         User Product is transferred to the recipient in perpetuity or for a
         fixed term (regardless of how the transaction is characterized), the
         Corresponding Source conveyed under this section must be accompanied
         by the Installation Information.  But this requirement does not apply
         if neither you nor any third party retains the ability to install
         modified object code on the User Product (for example, the work has
         been installed in ROM).
         
           The requirement to provide Installation Information does not include a
         requirement to continue to provide support service, warranty, or updates
         for a work that has been modified or installed by the recipient, or for
         the User Product in which it has been modified or installed.  Access to a
         network may be denied when the modification itself materially and
         adversely affects the operation of the network or violates the rules and
         protocols for communication across the network.
         
           Corresponding Source conveyed, and Installation Information provided,
         in accord with this section must be in a format that is publicly
         documented (and with an implementation available to the public in
         source code form), and must require no special password or key for
         unpacking, reading or copying.
         
           7. Additional Terms.
         
           "Additional permissions" are terms that supplement the terms of this
         License by making exceptions from one or more of its conditions.
         Additional permissions that are applicable to the entire Program shall
         be treated as though they were included in this License, to the extent
         that they are valid under applicable law.  If additional permissions
         apply only to part of the Program, that part may be used separately
         under those permissions, but the entire Program remains governed by
         this License without regard to the additional permissions.
         
           When you convey a copy of a covered work, you may at your option
         remove any additional permissions from that copy, or from any part of
         it.  (Additional permissions may be written to require their own
         removal in certain cases when you modify the work.)  You may place
         additional permissions on material, added by you to a covered work,
         for which you have or can give appropriate copyright permission.
         
           Notwithstanding any other provision of this License, for material you
         add to a covered work, you may (if authorized by the copyright holders of
         that material) supplement the terms of this License with terms:
         
             a) Disclaiming warranty or limiting liability differently from the
             terms of sections 15 and 16 of this License; or
         
             b) Requiring preservation of specified reasonable legal notices or
             author attributions in that material or in the Appropriate Legal
             Notices displayed by works containing it; or
         
             c) Prohibiting misrepresentation of the origin of that material, or
             requiring that modified versions of such material be marked in
             reasonable ways as different from the original version; or
         
             d) Limiting the use for publicity purposes of names of licensors or
             authors of the material; or
         
             e) Declining to grant rights under trademark law for use of some
             trade names, trademarks, or service marks; or
         
             f) Requiring indemnification of licensors and authors of that
             material by anyone who conveys the material (or modified versions of
             it) with contractual assumptions of liability to the recipient, for
             any liability that these contractual assumptions directly impose on
             those licensors and authors.
         
           All other non-permissive additional terms are considered "further
         restrictions" within the meaning of section 10.  If the Program as you
         received it, or any part of it, contains a notice stating that it is
         governed by this License along with a term that is a further
         restriction, you may remove that term.  If a license document contains
         a further restriction but permits relicensing or conveying under this
         License, you may add to a covered work material governed by the terms
         of that license document, provided that the further restriction does
         not survive such relicensing or conveying.
         
           If you add terms to a covered work in accord with this section, you
         must place, in the relevant source files, a statement of the
         additional terms that apply to those files, or a notice indicating
         where to find the applicable terms.
         
           Additional terms, permissive or non-permissive, may be stated in the
         form of a separately written license, or stated as exceptions;
         the above requirements apply either way.
         
           8. Termination.
         
           You may not propagate or modify a covered work except as expressly
         provided under this License.  Any attempt otherwise to propagate or
         modify it is void, and will automatically terminate your rights under
         this License (including any patent licenses granted under the third
         paragraph of section 11).
         
           However, if you cease all violation of this License, then your
         license from a particular copyright holder is reinstated (a)
         provisionally, unless and until the copyright holder explicitly and
         finally terminates your license, and (b) permanently, if the copyright
         holder fails to notify you of the violation by some reasonable means
         prior to 60 days after the cessation.
         
           Moreover, your license from a particular copyright holder is
         reinstated permanently if the copyright holder notifies you of the
         violation by some reasonable means, this is the first time you have
         received notice of violation of this License (for any work) from that
         copyright holder, and you cure the violation prior to 30 days after
         your receipt of the notice.
         
           Termination of your rights under this section does not terminate the
         licenses of parties who have received copies or rights from you under
         this License.  If your rights have been terminated and not permanently
         reinstated, you do not qualify to receive new licenses for the same
         material under section 10.
         
           9. Acceptance Not Required for Having Copies.
         
           You are not required to accept this License in order to receive or
         run a copy of the Program.  Ancillary propagation of a covered work
         occurring solely as a consequence of using peer-to-peer transmission
         to receive a copy likewise does not require acceptance.  However,
         nothing other than this License grants you permission to propagate or
         modify any covered work.  These actions infringe copyright if you do
         not accept this License.  Therefore, by modifying or propagating a
         covered work, you indicate your acceptance of this License to do so.
         
           10. Automatic Licensing of Downstream Recipients.
         
           Each time you convey a covered work, the recipient automatically
         receives a license from the original licensors, to run, modify and
         propagate that work, subject to this License.  You are not responsible
         for enforcing compliance by third parties with this License.
         
           An "entity transaction" is a transaction transferring control of an
         organization, or substantially all assets of one, or subdividing an
         organization, or merging organizations.  If propagation of a covered
         work results from an entity transaction, each party to that
         transaction who receives a copy of the work also receives whatever
         licenses to the work the party's predecessor in interest had or could
         give under the previous paragraph, plus a right to possession of the
         Corresponding Source of the work from the predecessor in interest, if
         the predecessor has it or can get it with reasonable efforts.
         
           You may not impose any further restrictions on the exercise of the
         rights granted or affirmed under this License.  For example, you may
         not impose a license fee, royalty, or other charge for exercise of
         rights granted under this License, and you may not initiate litigation
         (including a cross-claim or counterclaim in a lawsuit) alleging that
         any patent claim is infringed by making, using, selling, offering for
         sale, or importing the Program or any portion of it.
         
           11. Patents.
         
           A "contributor" is a copyright holder who authorizes use under this
         License of the Program or a work on which the Program is based.  The
         work thus licensed is called the contributor's "contributor version".
         
           A contributor's "essential patent claims" are all patent claims
         owned or controlled by the contributor, whether already acquired or
         hereafter acquired, that would be infringed by some manner, permitted
         by this License, of making, using, or selling its contributor version,
         but do not include claims that would be infringed only as a
         consequence of further modification of the contributor version.  For
         purposes of this definition, "control" includes the right to grant
         patent sublicenses in a manner consistent with the requirements of
         this License.
         
           Each contributor grants you a non-exclusive, worldwide, royalty-free
         patent license under the contributor's essential patent claims, to
         make, use, sell, offer for sale, import and otherwise run, modify and
         propagate the contents of its contributor version.
         
           In the following three paragraphs, a "patent license" is any express
         agreement or commitment, however denominated, not to enforce a patent
         (such as an express permission to practice a patent or covenant not to
         sue for patent infringement).  To "grant" such a patent license to a
         party means to make such an agreement or commitment not to enforce a
         patent against the party.
         
           If you convey a covered work, knowingly relying on a patent license,
         and the Corresponding Source of the work is not available for anyone
         to copy, free of charge and under the terms of this License, through a
         publicly available network server or other readily accessible means,
         then you must either (1) cause the Corresponding Source to be so
         available, or (2) arrange to deprive yourself of the benefit of the
         patent license for this particular work, or (3) arrange, in a manner
         consistent with the requirements of this License, to extend the patent
         license to downstream recipients.  "Knowingly relying" means you have
         actual knowledge that, but for the patent license, your conveying the
         covered work in a country, or your recipient's use of the covered work
         in a country, would infringe one or more identifiable patents in that
         country that you have reason to believe are valid.
         
           If, pursuant to or in connection with a single transaction or
         arrangement, you convey, or propagate by procuring conveyance of, a
         covered work, and grant a patent license to some of the parties
         receiving the covered work authorizing them to use, propagate, modify
         or convey a specific copy of the covered work, then the patent license
         you grant is automatically extended to all recipients of the covered
         work and works based on it.
         
           A patent license is "discriminatory" if it does not include within
         the scope of its coverage, prohibits the exercise of, or is
         conditioned on the non-exercise of one or more of the rights that are
         specifically granted under this License.  You may not convey a covered
         work if you are a party to an arrangement with a third party that is
         in the business of distributing software, under which you make payment
         to the third party based on the extent of your activity of conveying
         the work, and under which the third party grants, to any of the
         parties who would receive the covered work from you, a discriminatory
         patent license (a) in connection with copies of the covered work
         conveyed by you (or copies made from those copies), or (b) primarily
         for and in connection with specific products or compilations that
         contain the covered work, unless you entered into that arrangement,
         or that patent license was granted, prior to 28 March 2007.
         
           Nothing in this License shall be construed as excluding or limiting
         any implied license or other defenses to infringement that may
         otherwise be available to you under applicable patent law.
         
           12. No Surrender of Others' Freedom.
         
           If conditions are imposed on you (whether by court order, agreement or
         otherwise) that contradict the conditions of this License, they do not
         excuse you from the conditions of this License.  If you cannot convey a
         covered work so as to satisfy simultaneously your obligations under this
         License and any other pertinent obligations, then as a consequence you may
         not convey it at all.  For example, if you agree to terms that obligate you
         to collect a royalty for further conveying from those to whom you convey
         the Program, the only way you could satisfy both those terms and this
         License would be to refrain entirely from conveying the Program.
         
           13. Use with the GNU Affero General Public License.
         
           Notwithstanding any other provision of this License, you have
         permission to link or combine any covered work with a work licensed
         under version 3 of the GNU Affero General Public License into a single
         combined work, and to convey the resulting work.  The terms of this
         License will continue to apply to the part which is the covered work,
         but the special requirements of the GNU Affero General Public License,
         section 13, concerning interaction through a network will apply to the
         combination as such.
         
           14. Revised Versions of this License.
         
           The Free Software Foundation may publish revised and/or new versions of
         the GNU General Public License from time to time.  Such new versions will
         be similar in spirit to the present version, but may differ in detail to
         address new problems or concerns.
         
           Each version is given a distinguishing version number.  If the
         Program specifies that a certain numbered version of the GNU General
         Public License "or any later version" applies to it, you have the
         option of following the terms and conditions either of that numbered
         version or of any later version published by the Free Software
         Foundation.  If the Program does not specify a version number of the
         GNU General Public License, you may choose any version ever published
         by the Free Software Foundation.
         
           If the Program specifies that a proxy can decide which future
         versions of the GNU General Public License can be used, that proxy's
         public statement of acceptance of a version permanently authorizes you
         to choose that version for the Program.
         
           Later license versions may give you additional or different
         permissions.  However, no additional obligations are imposed on any
         author or copyright holder as a result of your choosing to follow a
         later version.
         
           15. Disclaimer of Warranty.
         
           THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY
         APPLICABLE LAW.  EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT
         HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY
         OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO,
         THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
         PURPOSE.  THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM
         IS WITH YOU.  SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF
         ALL NECESSARY SERVICING, REPAIR OR CORRECTION.
         
           16. Limitation of Liability.
         
           IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING
         WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS
         THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY
         GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE
         USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF
         DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD
         PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),
         EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF
         SUCH DAMAGES.
         
           17. Interpretation of Sections 15 and 16.
         
           If the disclaimer of warranty and limitation of liability provided
         above cannot be given local legal effect according to their terms,
         reviewing courts shall apply local law that most closely approximates
         an absolute waiver of all civil liability in connection with the
         Program, unless a warranty or assumption of liability accompanies a
         copy of the Program in return for a fee.
         
                              END OF TERMS AND CONDITIONS
         
                     How to Apply These Terms to Your New Programs
         
           If you develop a new program, and you want it to be of the greatest
         possible use to the public, the best way to achieve this is to make it
         free software which everyone can redistribute and change under these terms.
         
           To do so, attach the following notices to the program.  It is safest
         to attach them to the start of each source file to most effectively
         state the exclusion of warranty; and each file should have at least
         the "copyright" line and a pointer to where the full notice is found.
         
             <one line to give the program's name and a brief idea of what it does.>
             Copyright (C) <year>  <name of author>
         
             This program is free software: you can redistribute it and/or modify
             it under the terms of the GNU General Public License as published by
             the Free Software Foundation, either version 3 of the License, or
             (at your option) any later version.
         
             This program is distributed in the hope that it will be useful,
             but WITHOUT ANY WARRANTY; without even the implied warranty of
             MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
             GNU General Public License for more details.
         
             You should have received a copy of the GNU General Public License
             along with this program.  If not, see <http://www.gnu.org/licenses/>.
         
         Also add information on how to contact you by electronic and paper mail.
         
           If the program does terminal interaction, make it output a short
         notice like this when it starts in an interactive mode:
         
             <program>  Copyright (C) <year>  <name of author>
             This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'.
             This is free software, and you are welcome to redistribute it
             under certain conditions; type `show c' for details.
         
         The hypothetical commands `show w' and `show c' should show the appropriate
         parts of the General Public License.  Of course, your program's commands
         might be different; for a GUI interface, you would use an "about box".
         
           You should also get your employer (if you work as a programmer) or school,
         if any, to sign a "copyright disclaimer" for the program, if necessary.
         For more information on this, and how to apply and follow the GNU GPL, see
         <http://www.gnu.org/licenses/>.
         
           The GNU General Public License does not permit incorporating your program
         into proprietary programs.  If your program is a subroutine library, you
         may consider it more useful to permit linking proprietary applications with
         the library.  If this is what you want to do, use the GNU Lesser General
         Public License instead of this License.  But first, please read
         <http://www.gnu.org/philosophy/why-not-lgpl.html>. 
         
Classifier: Development Status :: 4 - Beta
Classifier: Intended Audience :: Developers
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: GNU General Public License v3 (GPLv3)
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: C++
Classifier: Programming Language :: Cython
Classifier: Programming Language :: Python :: 3.8
Classifier: Programming Language :: Python :: 3.9
Classifier: Programming Language :: Python :: 3.10
Classifier: Programming Language :: Python :: 3.11
Classifier: Programming Language :: Python :: 3.12
Classifier: Programming Language :: Python :: 3.13
Classifier: Programming Language :: Python :: Implementation :: CPython
Classifier: Programming Language :: Python :: Implementation :: PyPy
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Scientific/Engineering :: Medical Science Apps.
Classifier: Typing :: Typed
Project-URL: Homepage, https://github.com/althonos/pyfamsa/
Project-URL: Documentation, https://pyfamsa.readthedocs.io/en/stable/
Project-URL: Bug Tracker, https://github.com/althonos/pyfamsa/issues
Project-URL: Changelog, https://github.com/althonos/pyfamsa/blob/master/CHANGELOG.md
Project-URL: Coverage, https://codecov.io/gh/althonos/pyfamsa/
Project-URL: Builds, https://github.com/althonos/pyfamsa/actions
Project-URL: PyPI, https://pypi.org/project/pyfamsa
Requires-Python: >=3.8
Requires-Dist: scoring-matrices~=0.3.0
Provides-Extra: test
Requires-Dist: importlib-resources; python_version < "3.9" and extra == "test"
Description-Content-Type: text/markdown

# 🐍🧮 PyFAMSA [![Stars](https://img.shields.io/github/stars/althonos/pyfamsa.svg?style=social&maxAge=3600&label=Star)](https://github.com/althonos/pyfamsa/stargazers)

*[Cython](https://cython.org/) bindings and Python interface to [FAMSA](https://github.com/refresh-bio/FAMSA), an algorithm for ultra-scale multiple sequence alignments.*

[![Actions](https://img.shields.io/github/actions/workflow/status/althonos/pyfamsa/test.yml?branch=main&logo=github&style=flat-square&maxAge=300)](https://github.com/althonos/pyfamsa/actions)
[![Coverage](https://img.shields.io/codecov/c/gh/althonos/pyfamsa?style=flat-square&maxAge=3600&logo=codecov)](https://codecov.io/gh/althonos/pyfamsa/)
[![License](https://img.shields.io/badge/license-GPLv3-blue.svg?style=flat-square&maxAge=2678400)](https://choosealicense.com/licenses/gpl-3.0/)
[![PyPI](https://img.shields.io/pypi/v/pyfamsa.svg?style=flat-square&maxAge=3600&logo=PyPI)](https://pypi.org/project/pyfamsa)
[![Bioconda](https://img.shields.io/conda/vn/bioconda/pyfamsa?style=flat-square&maxAge=3600&logo=anaconda)](https://anaconda.org/bioconda/pyfamsa)
[![AUR](https://img.shields.io/aur/version/python-pyfamsa?logo=archlinux&style=flat-square&maxAge=3600)](https://aur.archlinux.org/packages/python-pyfamsa)
[![Wheel](https://img.shields.io/pypi/wheel/pyfamsa.svg?style=flat-square&maxAge=3600)](https://pypi.org/project/pyfamsa/#files)
[![Python Versions](https://img.shields.io/pypi/pyversions/pyfamsa.svg?style=flat-square&maxAge=600&logo=python)](https://pypi.org/project/pyfamsa/#files)
[![Python Implementations](https://img.shields.io/pypi/implementation/pyfamsa.svg?style=flat-square&maxAge=600&label=impl)](https://pypi.org/project/pyfamsa/#files)
[![Source](https://img.shields.io/badge/source-GitHub-303030.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/pyfamsa/)
[![Mirror](https://img.shields.io/badge/mirror-EMBL-009f4d?style=flat-square&maxAge=2678400)](https://git.embl.de/larralde/pyfamsa/)
[![Issues](https://img.shields.io/github/issues/althonos/pyfamsa.svg?style=flat-square&maxAge=600)](https://github.com/althonos/pyfamsa/issues)
[![Docs](https://img.shields.io/readthedocs/pyfamsa/latest?style=flat-square&maxAge=600)](https://pyfamsa.readthedocs.io)
[![Changelog](https://img.shields.io/badge/keep%20a-changelog-8A0707.svg?maxAge=2678400&style=flat-square)](https://github.com/althonos/pyfamsa/blob/main/CHANGELOG.md)
[![Downloads](https://img.shields.io/badge/dynamic/regex?url=https%3A%2F%2Fpepy.tech%2Fprojects%2Fpyfamsa&search=%5B0-9%5D%2B.%5B0-9%5D%2B(k%7CM)&style=flat-square&label=downloads&color=303f9f&cacheSeconds=86400)](https://pepy.tech/project/pyfamsa)


***⚠️ This package is based on FAMSA 2.***

## 🗺️ Overview

[FAMSA](https://github.com/refresh-bio/FAMSA) is a method published in
2016 by Deorowicz *et al.*[\[1\]](#ref1) for large-scale multiple sequence alignments.
It uses state-of-the-art time and memory optimizations as well as a fast
guide tree heuristic to reach very high performance and accuracy.

PyFAMSA is a Python module that provides bindings to [FAMSA](https://github.com/refresh-bio/FAMSA)
using [Cython](https://cython.org/). It implements a user-friendly, Pythonic
interface to align protein sequences using different parameters and access
results directly. It interacts with the FAMSA library interface, which has
the following advantages:

- **single dependency**: PyFAMSA is distributed as a Python package, so you
  can add it as a dependency to your project, and stop worrying about the
  FAMSA binary being present on the end-user machine.
- **no intermediate files**: Everything happens in memory, in a Python object
  you control, so you don't have to invoke the FAMSA CLI using a
  sub-process and temporary files.
- **friendly interface**: The different guide tree build methods and
  heuristics can be selected from the Python code with a simple keyword
  argument when configuring a new [`Aligner`](https://pyfamsa.readthedocs.io/en/stable/api/aligner.html#pyfamsa.Aligner).
- **custom scoring matrices**: You can use any custom scoring matrix from
  the [`scoring-matrices`](https://pypi.org/project/scoring-matrices) library
  in addition to the default MIQS to score the alignment.

## 🔧 Installing

PyFAMSA can be installed directly from [PyPI](https://pypi.org/project/pyfamsa/),
which hosts some pre-built wheels for the x86-64 and Aarch architectures
for Linux, MacOS and Windows, as well as the code required to compile from
source with Cython:
```console
$ pip install pyfamsa
```

Otherwise, PyFAMSA is also available as a [Bioconda](https://bioconda.github.io/)
package:
```console
$ conda install -c bioconda pyfamsa
```

Otherwise, have a look at the [Installation page](https://pyfamsa.readthedocs.io/en/stable/guide/install.html) of the [online documentation](https://pyfamsa.readthedocs.io/)

## 💡 Example

Let's create some sequences in memory, align them using the UPGMA method,
(without any heuristic), and simply print the alignment on screen:

```python
from pyfamsa import Aligner, Sequence

sequences = [
    Sequence(b"Sp8",  b"GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII"),
    Sequence(b"Sp10", b"DPAVLFVIMLGTITKFSSEWFFAWLGLEINMMVII"),
    Sequence(b"Sp26", b"AAAAAAAAALLTYLGLFLGTDYENFAAAAANAWLGLEINMMAQI"),
    Sequence(b"Sp6",  b"ASGAILTLGIYLFTLCAVISVSWYLAWLGLEINMMAII"),
    Sequence(b"Sp17", b"FAYTAPDLLLIGFLLKTVATFGDTWFQLWQGLDLNKMPVF"),
    Sequence(b"Sp33", b"PTILNIAGLHMETDINFSLAWFQAWGGLEINKQAIL"),
]

aligner = Aligner(guide_tree="upgma")
msa = aligner.align(sequences)

for sequence in msa:
      print(sequence.id.decode().ljust(10), sequence.sequence.decode())
```

This should output the following:
```
Sp10       --------DPAVLFVIMLGTIT-KFS--SEWFFAWLGLEINMMVII
Sp17       ---FAYTAPDLLLIGFLLKTVA-TFG--DTWFQLWQGLDLNKMPVF
Sp26       AAAAAAAAALLTYLGLFLGTDYENFA--AAAANAWLGLEINMMAQI
Sp33       -------PTILNIAGLHMETDI-NFS--LAWFQAWGGLEINKQAIL
Sp6        ------ASGAILTLGIYLFTLCAVIS--VSWYLAWLGLEINMMAII
Sp8        ------GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII
```

## 🧶 Thread-safety

`Aligner` objects are thread-safe, and the `align` method is re-entrant. You
could batch process several alignments in parallel using a
[`ThreadPool`](https://docs.python.org/3/library/multiprocessing.html#multiprocessing.pool.ThreadPool) with a single
aligner object:
```python
import glob
import multiprocessing.pool
import Bio.SeqIO
from pyfamsa import Aligner, Sequence

families = [
    [ Sequence(r.id.encode(), r.seq.encode()) for r in Bio.SeqIO.parse(file, "fasta") ]
    for file in glob.glob("pyfamsa/tests/data/*.faa")
]

aligner = Aligner()
with multiprocessing.pool.ThreadPool() as pool:
    alignments = pool.map(aligner.align, families)
```

<!-- ## ⏱️ Benchmarks -->

## 🔎 See Also

Done with your protein alignment? You may be interested in trimming it: in that
case, you could use the [`pytrimal`](https://github.com/althonos/pytrimal) Python
package, which wraps [trimAl](http://trimal.cgenomics.org/) 2.0. Or perhaps
you want to build a HMM from the alignment? Then maybe have a look at
[`pyhmmer`](https://github.com/althonos/pyhmmer), a Python package which
wraps [HMMER](http://hmmer.org/).

## 💭 Feedback

### ⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the [GitHub issue tracker](https://github.com/althonos/pyfamsa/issues)
if you need to report or ask something. If you are filing in on a bug,
please include as much information as you can about the issue, and try to
recreate the same bug in a simple, easily reproducible situation.


### 🏗️ Contributing

Contributions are more than welcome! See
[`CONTRIBUTING.md`](https://github.com/althonos/pyfamsa/blob/main/CONTRIBUTING.md)
for more details.


## 📋 Changelog

This project adheres to [Semantic Versioning](http://semver.org/spec/v2.0.0.html)
and provides a [changelog](https://github.com/althonos/pyfamsa/blob/main/CHANGELOG.md)
in the [Keep a Changelog](http://keepachangelog.com/en/1.0.0/) format.


## ⚖️ License

This library is provided under the [GNU General Public License v3.0](https://choosealicense.com/licenses/gpl-3.0/). FAMSA is developed by the
[REFRESH Bioinformatics Group](https://refresh-bio.github.io/) and is
distributed under the terms of the GPLv3 as well. See `vendor/FAMSA/LICENSE`
for more information. In addition, FAMSA vendors several libraries for
compatibility, all of which are redistributed with PyFAMSA under their own
terms: `atomic_wait` (MIT License), `mimalloc` (MIT License), `libdeflate`
(MIT License),  Boost (Boost Software License).

*This project is in no way not affiliated, sponsored, or otherwise endorsed
by the [FAMSA authors](https://github.com/refresh-bio). It was developed
by [Martin Larralde](https://github.com/althonos/) during his PhD project
at the [European Molecular Biology Laboratory](https://www.embl.de/) in
the [Zeller team](https://github.com/zellerlab).*


## 📚 References

- <a id="ref1">\[1\]</a> Deorowicz, Sebastian, Debudaj-Grabysz, Agnieszka & Gudyś, Adam. ‘FAMSA: Fast and accurate multiple sequence alignment of huge protein families’. Sci Rep 6, 33964 (2016). [doi:10.1038/srep33964](https://doi.org/10.1038/srep33964)
